Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) |
Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins) |
Protein Integrase [56351] (1 species) |
Species Bacteriophage HP1 [TaxId:10690] [56352] (1 PDB entry) |
Domain d1aihb_: 1aih B: [42150] complexed with mg, so4 |
PDB Entry: 1aih (more details), 2.5 Å
SCOPe Domain Sequences for d1aihb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aihb_ d.163.1.1 (B:) Integrase {Bacteriophage HP1 [TaxId: 10690]} elaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitftnt kskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfash fmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq
Timeline for d1aihb_: