![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.22: GUN4-associated domain [140825] (2 proteins) PfamB PB089177 this is a repeat family; one repeat unit is 1z3x A:34-71 found in domain |
![]() | Protein Mg-chelatase cofactor Gun4 [140826] (2 species) Ycf53-like protein sll0558 |
![]() | Species Synechocystis sp. [TaxId:1111708] [273033] (5 PDB entries) |
![]() | Domain d7e2ta1: 7e2t A:4-82 [421493] Other proteins in same PDB: d7e2ta2 automated match to d1y6ia1 complexed with cl, uyc |
PDB Entry: 7e2t (more details), 1.1 Å
SCOPe Domain Sequences for d7e2ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7e2ta1 a.118.1.22 (A:4-82) Mg-chelatase cofactor Gun4 {Synechocystis sp. [TaxId: 1111708]} nltelsqqlhdasekkqltaiaalaemgeggqgilldylaknvplekpvlavgnvyqtlr nleqetittqlqrnyptgi
Timeline for d7e2ta1: