Lineage for d1aiha_ (1aih A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) 
Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins) 
Protein Integrase [56351] (1 species) Species Bacteriophage HP1 [TaxId:10690] [56352] (1 PDB entry) 
Domain d1aiha_: 1aih A: [42149]
Details for d1aiha_
PDB Entry: 1aih (more details), 2.5 Å
PDB Description: catalytic domain of bacteriophage hp1 integrase
SCOP Domain Sequences for d1aiha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aiha_ d.163.1.1 (A:) Integrase {Bacteriophage HP1}
etelaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitft
ntkskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfa
shfmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq
SCOP Domain Coordinates for d1aiha_:
Click to download the PDB-style file with coordinates for d1aiha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aiha_:
- d1aiha_ appears in SCOP 1.57
- d1aiha_ appears in the current release, SCOPe 2.08
View in 3D
