Lineage for d7dw3a1 (7dw3 A:3-84)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880245Species Salix babylonica [TaxId:75706] [420114] (8 PDB entries)
  8. 3085156Domain d7dw3a1: 7dw3 A:3-84 [421473]
    Other proteins in same PDB: d7dw3a2
    automated match to d5g5fa1
    mutant

Details for d7dw3a1

PDB Entry: 7dw3 (more details), 1.93 Å

PDB Description: crystal structure of a glutathione s-transferase mutant sbgstu6(i55t) from salix babylonica
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d7dw3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dw3a1 c.47.1.0 (A:3-84) automated matches {Salix babylonica [TaxId: 75706]}
ksdvkllgawpspfvmrprialniksveyefleetlgsksqlllesnpvhkktpvlihgg
kpiceslviveyidevwspgpa

SCOPe Domain Coordinates for d7dw3a1:

Click to download the PDB-style file with coordinates for d7dw3a1.
(The format of our PDB-style files is described here.)

Timeline for d7dw3a1:

  • d7dw3a1 is new in SCOPe 2.08-stable

3085156
d7dw3a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d7dw3a2