Lineage for d1lthr2 (1lth R:150-319)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420654Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 420655Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 420656Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 420663Protein Lactate dehydrogenase [56339] (13 species)
  7. 420675Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [56346] (2 PDB entries)
  8. 420678Domain d1lthr2: 1lth R:150-319 [42146]
    Other proteins in same PDB: d1lthr1, d1ltht1

Details for d1lthr2

PDB Entry: 1lth (more details), 2.5 Å

PDB Description: t and r states in the crystals of bacterial l-lactate dehydrogenase reveal the mechanism for allosteric control

SCOP Domain Sequences for d1lthr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lthr2 d.162.1.1 (R:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2}
tnldsarlrfliaqqtgvnvknvhayiagehgdsevplwesatiggvpmsdwtplpghdp
ldadkreeihqevknaaykiingkgatnyaigmsgvdiieavlhdtnrilpvssmlkdfh
gisdicmsvptllnrqgvnntintpvsdkelaalkrsaetlketaaqfgf

SCOP Domain Coordinates for d1lthr2:

Click to download the PDB-style file with coordinates for d1lthr2.
(The format of our PDB-style files is described here.)

Timeline for d1lthr2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lthr1