Lineage for d1lldb2 (1lld B:150-319)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36979Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 36980Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 36981Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins)
  6. 36988Protein Lactate dehydrogenase [56339] (8 species)
  7. 37000Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [56346] (2 PDB entries)
  8. 37002Domain d1lldb2: 1lld B:150-319 [42145]
    Other proteins in same PDB: d1llda1, d1lldb1

Details for d1lldb2

PDB Entry: 1lld (more details), 2 Å

PDB Description: molecular basis of allosteric activation of bacterial l-lactate dehydrogenase

SCOP Domain Sequences for d1lldb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lldb2 d.162.1.1 (B:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2}
tnldsarlrfliaqqtgvnvknvhayiagehgdsevplwesatiggvpmsdwtplpghdp
ldadkreeihqevknaaykiingkgatnyaigmsgvdiieavlhdtnrilpvssmlkdfh
gisdicmsvptllnrqgvnntintpvsdkelaalkrsaetlketaaqfgf

SCOP Domain Coordinates for d1lldb2:

Click to download the PDB-style file with coordinates for d1lldb2.
(The format of our PDB-style files is described here.)

Timeline for d1lldb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lldb1