SCOP 1.57: Domain d1llda2: 1lld A:150-319

Lineage for d1llda2 (1lld A:150-319)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)

4. Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)

6. Protein Lactate dehydrogenase [56339] (10 species)

7. Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [56346] (2 PDB entries)

8. Domain d1llda2: 1lld A:150-319 [42144]
   Other proteins in same PDB: d1llda1, d1lldb1

Details for d1llda2

PDB Entry: 1lld, 2 Å

PDB Description: molecular basis of allosteric activation of bacterial l-lactate dehydrogenase

SCOP Domain Sequences for d1llda2:

Sequence; same for both SEQRES and ATOM records:

>d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2}
tnldsarlrfliaqqtgvnvknvhayiagehgdsevplwesatiggvpmsdwtplpghdp
ldadkreeihqevknaaykiingkgatnyaigmsgvdiieavlhdtnrilpvssmlkdfh
gisdicmsvptllnrqgvnntintpvsdkelaalkrsaetlketaaqfgf

Timeline for d1llda2:

• d1llda2 first appeared (with stable ids) in SCOP 1.55
  
• d1llda2 appears in SCOP 1.59
  
• d1llda2 appears in the current release, SCOPe 2.08