Lineage for d2ldba2 (2ldb A:163-331)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2604681Protein Lactate dehydrogenase [56339] (20 species)
  7. 2604687Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
  8. 2604696Domain d2ldba2: 2ldb A:163-331 [42142]
    Other proteins in same PDB: d2ldba1, d2ldbb1, d2ldbc1, d2ldbd1
    complexed with fbp, nad, so4

Details for d2ldba2

PDB Entry: 2ldb (more details), 3 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2ldba2:

Sequence, based on SEQRES records: (download)

>d2ldba2 d.162.1.1 (A:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr

Sequence, based on observed residues (ATOM records): (download)

>d2ldba2 d.162.1.1 (A:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskdler
ifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyig
vpavinrngirevieielnddeknrfhhsaatlksvlaraftr

SCOPe Domain Coordinates for d2ldba2:

Click to download the PDB-style file with coordinates for d2ldba2.
(The format of our PDB-style files is described here.)

Timeline for d2ldba2: