Lineage for d2ldb_2 (2ldb 163-331)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513617Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 513618Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 513619Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 513626Protein Lactate dehydrogenase [56339] (14 species)
  7. 513630Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
  8. 513640Domain d2ldb_2: 2ldb 163-331 [42142]
    Other proteins in same PDB: d2ldb_1

Details for d2ldb_2

PDB Entry: 2ldb (more details), 3 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase

SCOP Domain Sequences for d2ldb_2:

Sequence, based on SEQRES records: (download)

>d2ldb_2 d.162.1.1 (163-331) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr

Sequence, based on observed residues (ATOM records): (download)

>d2ldb_2 d.162.1.1 (163-331) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskdler
ifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyig
vpavinrngirevieielnddeknrfhhsaatlksvlaraftr

SCOP Domain Coordinates for d2ldb_2:

Click to download the PDB-style file with coordinates for d2ldb_2.
(The format of our PDB-style files is described here.)

Timeline for d2ldb_2: