Lineage for d1ldnh2 (1ldn H:163-330)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737029Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 737030Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 737031Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 737038Protein Lactate dehydrogenase [56339] (15 species)
  7. 737042Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
  8. 737050Domain d1ldnh2: 1ldn H:163-330 [42140]
    Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1
    complexed with fbp, nad, oxm

Details for d1ldnh2

PDB Entry: 1ldn (more details), 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution
PDB Compounds: (H:) l-lactate dehydrogenase

SCOP Domain Sequences for d1ldnh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldnh2 d.162.1.1 (H:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft

SCOP Domain Coordinates for d1ldnh2:

Click to download the PDB-style file with coordinates for d1ldnh2.
(The format of our PDB-style files is described here.)

Timeline for d1ldnh2: