SCOP 1.73: Domain d1ldnh2: 1ldn H:163-330

Lineage for d1ldnh2 (1ldn H:163-330)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Lactate dehydrogenase [56339] (15 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)

8. Domain d1ldnh2: 1ldn H:163-330 [42140]
   Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1
   complexed with fbp, nad, oxm

Details for d1ldnh2

PDB Entry: 1ldn, 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution

PDB Compounds: (H:) l-lactate dehydrogenase

SCOP Domain Sequences for d1ldnh2:

Sequence; same for both SEQRES and ATOM records:

>d1ldnh2 d.162.1.1 (H:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft

Timeline for d1ldnh2:

• d1ldnh2 first appeared (with stable ids) in SCOP 1.55
  
• d1ldnh2 appears in SCOP 1.71
  
• d1ldnh2 appears in SCOP 1.75
  
• d1ldnh2 appears in the current release, SCOPe 2.08