SCOPe 2.08: Domain d7dw2b1: 7dw2 B:3-84

Lineage for d7dw2b1 (7dw2 B:3-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Salix babylonica [TaxId:75706] [420114] (8 PDB entries)

8. Domain d7dw2b1: 7dw2 B:3-84 [421399]
   Other proteins in same PDB: d7dw2a2, d7dw2b2, d7dw2c2, d7dw2d2
   automated match to d5g5fa1

Details for d7dw2b1

PDB Entry: 7dw2, 1.74 Å

PDB Description: crystal structure of a glutathione s-transferase sbgstu6 from salix babylonica

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d7dw2b1:

Sequence; same for both SEQRES and ATOM records:

>d7dw2b1 c.47.1.0 (B:3-84) automated matches {Salix babylonica [TaxId: 75706]}
ksdvkllgawpspfvmrprialniksveyefleetlgsksqlllesnpvhkkipvlihgg
kpiceslviveyidevwspgpa

Timeline for d7dw2b1:

• d7dw2b1 is new in SCOPe 2.08-stable