Lineage for d7dqjb_ (7dqj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974033Species Escherichia coli [TaxId:83333] [271298] (26 PDB entries)
  8. 3085063Domain d7dqjb_: 7dqj B: [421380]
    automated match to d5z9qb_
    complexed with ax7, hfo, po4

Details for d7dqjb_

PDB Entry: 7dqj (more details), 1.92 Å

PDB Description: e. coli gyrb atpase domain in complex with 3,4-dihydroxyacetophenone
PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d7dqjb_:

Sequence, based on SEQRES records: (download)

>d7dqjb_ d.122.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
ldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqddg
rgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqklelviq
regkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrels
flnsgvsirlrdkrdgkedhfhyegg

Sequence, based on observed residues (ATOM records): (download)

>d7dqjb_ d.122.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
ldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqddg
rgiptgihpeegvsaaevimtvlgvgvsvvnalsqklelviqregkihrqiyehgvpqap
lavtgetektgtmvrfwpsletftnvtefeyeilakrlrelsflnsgvsirlrdkrdgke
dhfhyegg

SCOPe Domain Coordinates for d7dqjb_:

Click to download the PDB-style file with coordinates for d7dqjb_.
(The format of our PDB-style files is described here.)

Timeline for d7dqjb_:

  • d7dqjb_ is new in SCOPe 2.08-stable