SCOP 1.67: Domain d1ldnf2: 1ldn F:163-330

Lineage for d1ldnf2 (1ldn F:163-330)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Lactate dehydrogenase [56339] (13 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)

8. Domain d1ldnf2: 1ldn F:163-330 [42138]
   Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1

Details for d1ldnf2

PDB Entry: 1ldn, 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution

SCOP Domain Sequences for d1ldnf2:

Sequence; same for both SEQRES and ATOM records:

>d1ldnf2 d.162.1.1 (F:163-330) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft

Timeline for d1ldnf2:

• d1ldnf2 first appeared (with stable ids) in SCOP 1.55
  
• d1ldnf2 appears in SCOP 1.65
  
• d1ldnf2 appears in SCOP 1.69
  
• d1ldnf2 appears in the current release, SCOPe 2.08