Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) |
Protein Lactate dehydrogenase [56339] (14 species) |
Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries) |
Domain d1ldne2: 1ldn E:163-330 [42137] Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1 |
PDB Entry: 1ldn (more details), 2.5 Å
SCOP Domain Sequences for d1ldne2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldne2 d.162.1.1 (E:163-330) Lactate dehydrogenase {Bacillus stearothermophilus} tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft
Timeline for d1ldne2: