Lineage for d1ldnb2 (1ldn B:163-330)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 613582Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 613583Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 613584Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 613591Protein Lactate dehydrogenase [56339] (15 species)
  7. 613595Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
  8. 613597Domain d1ldnb2: 1ldn B:163-330 [42134]
    Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1

Details for d1ldnb2

PDB Entry: 1ldn (more details), 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution

SCOP Domain Sequences for d1ldnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldnb2 d.162.1.1 (B:163-330) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft

SCOP Domain Coordinates for d1ldnb2:

Click to download the PDB-style file with coordinates for d1ldnb2.
(The format of our PDB-style files is described here.)

Timeline for d1ldnb2: