Class a: All alpha proteins [46456] (290 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (17 species) not a true protein |
Species Enterococcus hirae [TaxId:768486] [324662] (7 PDB entries) |
Domain d7dqcf3: 7dqc F:352-453 [421315] Other proteins in same PDB: d7dqce1, d7dqce2, d7dqcf1, d7dqcf2 automated match to d3vr2d3 complexed with gol; mutant |
PDB Entry: 7dqc (more details), 2.71 Å
SCOPe Domain Sequences for d7dqcf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dqcf3 a.69.1.0 (F:352-453) automated matches {Enterococcus hirae [TaxId: 768486]} kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene yvnqgfytnrtitetldlgwellamlprtelkrikddlldky
Timeline for d7dqcf3: