SCOP 1.67: Domain d8ldh_2: 8ldh 161-329

Lineage for d8ldh_2 (8ldh 161-329)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Lactate dehydrogenase [56339] (13 species)

7. Species Dogfish (Squalus acanthias) [TaxId:7797] [56342] (3 PDB entries)

8. Domain d8ldh_2: 8ldh 161-329 [42129]
   Other proteins in same PDB: d8ldh_1
   complexed with cit

Details for d8ldh_2

PDB Entry: 8ldh, 2.8 Å

PDB Description: refined crystal structure of dogfish m4 apo-lactate dehydrogenase

SCOP Domain Sequences for d8ldh_2:

Sequence; same for both SEQRES and ATOM records:

>d8ldh_2 d.162.1.1 (161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias)}
sgcnldsarfrylmgerlgvhscschgwvigehgdsvpsvwsgmnvasiklhpldgtnkd
kqdwkklhkdvvdsayeviklkgytswaiglsvadlaetimknlcrvhpvstmvkdfygi
kdnvflslpcvlndhgisnivkmklkpneeqqlqksattlwdiqkdlkf

Timeline for d8ldh_2:

• d8ldh_2 first appeared (with stable ids) in SCOP 1.55
  
• d8ldh_2 appears in SCOP 1.65
  
• d8ldh_2 appears in SCOP 1.69
  
• d8ldh_2 appears in the current release, SCOPe 2.08, called d8ldha2