Lineage for d6ldha2 (6ldh A:161-329)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232592Species Dogfish (Squalus acanthias) [TaxId:7797] [56342] (3 PDB entries)
  8. 2232593Domain d6ldha2: 6ldh A:161-329 [42128]
    Other proteins in same PDB: d6ldha1
    complexed with so4

Details for d6ldha2

PDB Entry: 6ldh (more details), 2 Å

PDB Description: refined crystal structure of dogfish m4 apo-lactate dehydrogenase
PDB Compounds: (A:) m4 apo-lactate dehydrogenase

SCOPe Domain Sequences for d6ldha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ldha2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]}
sgcnldsarfrylmgerlgvhscschgwvigehgdsvpsvwsgmnvasiklhpldgtnkd
kqdwkklhkdvvdsayeviklkgytswaiglsvadlaetimknlcrvhpvstmvkdfygi
kdnvflslpcvlndhgisnivkmklkpneeqqlqksattlwdiqkdlkf

SCOPe Domain Coordinates for d6ldha2:

Click to download the PDB-style file with coordinates for d6ldha2.
(The format of our PDB-style files is described here.)

Timeline for d6ldha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ldha1