Lineage for d7d75c_ (7d75 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935699Family d.17.1.1: Monellin [54404] (2 proteins)
  6. 2935722Protein automated matches [190339] (1 species)
    not a true protein
  7. 2935723Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (15 PDB entries)
  8. 3084946Domain d7d75c_: 7d75 C: [421263]
    automated match to d1mola_
    complexed with mes, mg, so4; mutant

Details for d7d75c_

PDB Entry: 7d75 (more details), 2.5 Å

PDB Description: x-ray structure of a domain-swapped dimer of monellin with yedkg loop- 1 mutant
PDB Compounds: (C:) Single chain monellin

SCOPe Domain Sequences for d7d75c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d75c_ d.17.1.1 (C:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyedkgyeyqlyvya
sdklfradisedyktrgrkllrfngpvppp

SCOPe Domain Coordinates for d7d75c_:

Click to download the PDB-style file with coordinates for d7d75c_.
(The format of our PDB-style files is described here.)

Timeline for d7d75c_:

  • d7d75c_ is new in SCOPe 2.08-stable