Lineage for d2ldx_2 (2ldx 160-331)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513617Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 513618Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 513619Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 513626Protein Lactate dehydrogenase [56339] (14 species)
  7. 513683Species Mouse (Mus musculus) [TaxId:10090] [56341] (1 PDB entry)
  8. 513684Domain d2ldx_2: 2ldx 160-331 [42126]
    Other proteins in same PDB: d2ldx_1

Details for d2ldx_2

PDB Entry: 2ldx (more details), 2.96 Å

PDB Description: characterization of the antigenic sites on the refined 3-angstroms resolution structure of mouse testicular lactate dehydrogenase c4

SCOP Domain Sequences for d2ldx_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ldx_2 d.162.1.1 (160-331) Lactate dehydrogenase {Mouse (Mus musculus)}
sgcnldsarfryligeklgvnptschgwvlgehgdssvpiwsgvnvagvtlkslnpaigt
dknkqhwknvhkqvveggyevldmkgytswaiglsvtdlarsilknlkrvhpvttlvkgf
hgikeevflsipcvlgesgitdfvkvnmtaeeegllkksadtlwnmqknlel

SCOP Domain Coordinates for d2ldx_2:

Click to download the PDB-style file with coordinates for d2ldx_2.
(The format of our PDB-style files is described here.)

Timeline for d2ldx_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ldx_1