Lineage for d2ldx_2 (2ldx 160-331)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily) Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) 
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins) Protein Lactate dehydrogenase [56339] (8 species) 
Species Mouse (Mus musculus) [TaxId:10090] [56341] (1 PDB entry) 
Domain d2ldx_2: 2ldx 160-331 [42126]
Other proteins in same PDB: d2ldx_1
Details for d2ldx_2
PDB Entry: 2ldx (more details), 2.96 Å
PDB Description: characterization of the antigenic sites on the refined 3-angstroms resolution structure of mouse testicular lactate dehydrogenase c4
SCOP Domain Sequences for d2ldx_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ldx_2 d.162.1.1 (160-331) Lactate dehydrogenase {Mouse (Mus musculus)}
sgcnldsarfryligeklgvnptschgwvlgehgdssvpiwsgvnvagvtlkslnpaigt
dknkqhwknvhkqvveggyevldmkgytswaiglsvtdlarsilknlkrvhpvttlvkgf
hgikeevflsipcvlgesgitdfvkvnmtaeeegllkksadtlwnmqknlel
SCOP Domain Coordinates for d2ldx_2:
Click to download the PDB-style file with coordinates for d2ldx_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ldx_2:
- d2ldx_2 appears in SCOP 1.57
- d2ldx_2 appears in the current release, SCOPe 2.08, called d2ldxa2
View in 3D
