SCOPe 2.08: Domain d7dn8b1: 7dn8 B:17-177

Lineage for d7dn8b1 (7dn8 B:17-177)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (17 species)

7. Species Homo sapiens [TaxId:9606] [421238] (1 PDB entry)

8. Domain d7dn8b1: 7dn8 B:17-177 [421254]
   Other proteins in same PDB: d7dn8b2, d7dn8d2, d7dn8f2, d7dn8h2
   automated match to d1mr3f_
   complexed with gdp, mg

Details for d7dn8b1

PDB Entry: 7dn8, 2.61 Å

PDB Description: crystal structure of salmonella effector sopf in complex with arf1

PDB Compounds: (B:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d7dn8b1:

Sequence; same for both SEQRES and ATOM records:

>d7dn8b1 c.37.1.8 (B:17-177) ADP-ribosylation factor {Homo sapiens [TaxId: 9606]}
emrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkirp
lwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamna
aeitdklglhslrhrnwyiqatcatsgdglyegldwlsnql

Timeline for d7dn8b1:

• d7dn8b1 is new in SCOPe 2.08-stable