Lineage for d9ldbb2 (9ldb B:163-331)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 613582Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 613583Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 613584Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 613591Protein Lactate dehydrogenase [56339] (15 species)
  7. 613652Species Pig (Sus scrofa) [TaxId:9823] [56340] (3 PDB entries)
  8. 613656Domain d9ldbb2: 9ldb B:163-331 [42124]
    Other proteins in same PDB: d9ldba1, d9ldbb1
    complexed with nad, oxm, so4

Details for d9ldbb2

PDB Entry: 9ldb (more details), 2.2 Å

PDB Description: design and synthesis of new enzymes based on the lactate dehydrogenase framework

SCOP Domain Sequences for d9ldbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d9ldbb2 d.162.1.1 (B:163-331) Lactate dehydrogenase {Pig (Sus scrofa)}
sgcnldsarfrylmgerlgvhplschgwilgehgdssvpvwsgvnvagvslknlhpelgt
dadkehwkavhkevvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmikgl
ygikenvflsvpcilgqngisdvvkvtltpeeeahlkksadtlwgiqkelqf

SCOP Domain Coordinates for d9ldbb2:

Click to download the PDB-style file with coordinates for d9ldbb2.
(The format of our PDB-style files is described here.)

Timeline for d9ldbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d9ldbb1