Lineage for d9ldba2 (9ldb A:163-331)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232746Species Pig (Sus scrofa) [TaxId:9823] [56340] (3 PDB entries)
  8. 2232749Domain d9ldba2: 9ldb A:163-331 [42123]
    Other proteins in same PDB: d9ldba1, d9ldbb1
    complexed with nad, oxm, so4

Details for d9ldba2

PDB Entry: 9ldb (more details), 2.2 Å

PDB Description: design and synthesis of new enzymes based on the lactate dehydrogenase framework
PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d9ldba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d9ldba2 d.162.1.1 (A:163-331) Lactate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
sgcnldsarfrylmgerlgvhplschgwilgehgdssvpvwsgvnvagvslknlhpelgt
dadkehwkavhkevvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmikgl
ygikenvflsvpcilgqngisdvvkvtltpeeeahlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d9ldba2:

Click to download the PDB-style file with coordinates for d9ldba2.
(The format of our PDB-style files is described here.)

Timeline for d9ldba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d9ldba1