Lineage for d9ldta2 (9ldt A:163-331)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737029Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 737030Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 737031Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 737038Protein Lactate dehydrogenase [56339] (15 species)
  7. 737108Species Pig (Sus scrofa) [TaxId:9823] [56340] (3 PDB entries)
  8. 737109Domain d9ldta2: 9ldt A:163-331 [42121]
    Other proteins in same PDB: d9ldta1, d9ldtb1

Details for d9ldta2

PDB Entry: 9ldt (more details), 2 Å

PDB Description: design and synthesis of new enzymes based on the lactate dehydrogenase framework
PDB Compounds: (A:) lactate dehydrogenase

SCOP Domain Sequences for d9ldta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d9ldta2 d.162.1.1 (A:163-331) Lactate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
sgcnldsarfrylmgerlgvhplschgwilgehgdssvpvwsgvnvagvslknlhpelgt
dadkehwkavhkevvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmikgl
ygikenvflsvpcilgqngisdvvkvtltpeeeahlkksadtlwgiqkelqf

SCOP Domain Coordinates for d9ldta2:

Click to download the PDB-style file with coordinates for d9ldta2.
(The format of our PDB-style files is described here.)

Timeline for d9ldta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d9ldta1