Lineage for d1hyhd2 (1hyh D:167-329)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1440933Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1440934Protein L-2-hydroxyisocapronate dehydrogenase, L-HICDH [56337] (1 species)
  7. 1440935Species Lactobacillus confusus [TaxId:1583] [56338] (1 PDB entry)
  8. 1440939Domain d1hyhd2: 1hyh D:167-329 [42120]
    Other proteins in same PDB: d1hyha1, d1hyhb1, d1hyhc1, d1hyhd1
    complexed with nad, so4

Details for d1hyhd2

PDB Entry: 1hyh (more details), 2.2 Å

PDB Description: crystal structure of l-2-hydroxyisocaproate dehydrogenase from lactobacillus confusus at 2.2 angstroms resolution-an example of strong asymmetry between subunits
PDB Compounds: (D:) l-2-hydroxyisocaproate dehydrogenase

SCOPe Domain Sequences for d1hyhd2:

Sequence, based on SEQRES records: (download)

>d1hyhd2 d.162.1.1 (D:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]}
gtlldtarmqravgeafdldprsvsgynlgehgnsqfvawstvrvmgqpivtladagdid
laaieeearkggftvlngkgytsygvatsairiakavmadahaelvvsnrrddmgmylsy
paiigrdgvlaettldlttdeqekllqsrdyiqqrfdeivdtl

Sequence, based on observed residues (ATOM records): (download)

>d1hyhd2 d.162.1.1 (D:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]}
gtlldtarmqravgeafdldprsvsgynlgehgnsqfvawstvrvmgqpivtladaidla
aieeearkggftvlngkgytsygvatsairiakavmadahaelvvsnrrddmgmylsypa
iigrdgvlaettldlttdeqekllqsrdyiqqrfdeivdtl

SCOPe Domain Coordinates for d1hyhd2:

Click to download the PDB-style file with coordinates for d1hyhd2.
(The format of our PDB-style files is described here.)

Timeline for d1hyhd2: