Lineage for d7djia1 (7dji A:2-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819477Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2819576Protein automated matches [190922] (2 species)
    not a true protein
  7. 2819577Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)
  8. 3084869Domain d7djia1: 7dji A:2-205 [421186]
    Other proteins in same PDB: d7djia2, d7djib2, d7djic2, d7djid2, d7djie2
    automated match to d7ndvg_
    complexed with h8u, nag

Details for d7djia1

PDB Entry: 7dji (more details), 2.2 Å

PDB Description: crystal structure of lymnaea stagnalis acetylcholine binding protein (achbp) complexed with paraherquamide a
PDB Compounds: (A:) acetylcholine-binding protein

SCOPe Domain Sequences for d7djia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7djia1 b.96.1.1 (A:2-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d7djia1:

Click to download the PDB-style file with coordinates for d7djia1.
(The format of our PDB-style files is described here.)

Timeline for d7djia1:

  • d7djia1 is new in SCOPe 2.08-stable