Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries) |
Domain d7djia1: 7dji A:2-205 [421186] Other proteins in same PDB: d7djia2, d7djib2, d7djic2, d7djid2, d7djie2 automated match to d7ndvg_ complexed with h8u, nag |
PDB Entry: 7dji (more details), 2.2 Å
SCOPe Domain Sequences for d7djia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7djia1 b.96.1.1 (A:2-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn svtysccpeayedvevslnfrkkg
Timeline for d7djia1: