Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins) |
Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries) |
Domain d7dh5g_: 7dh5 G: [421180] Other proteins in same PDB: d7dh5b1, d7dh5b2 automated match to d2trcg_ complexed with h6u |
PDB Entry: 7dh5 (more details), 3.16 Å
SCOPe Domain Sequences for d7dh5g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dh5g_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} aqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpf
Timeline for d7dh5g_: