Lineage for d1b8ua2 (1b8u A:159-329)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206813Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2206814Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2206815Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 protein domains)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2207060Protein Malate dehydrogenase [56329] (12 species)
  7. 2207061Species Aquaspirillum arcticum [TaxId:87645] [56336] (3 PDB entries)
  8. 2207064Domain d1b8ua2: 1b8u A:159-329 [42116]
    Other proteins in same PDB: d1b8ua1
    complexed with nad, oaa

Details for d1b8ua2

PDB Entry: 1b8u (more details), 2.5 Å

PDB Description: malate dehydrogenase from aquaspirillum arcticum
PDB Compounds: (A:) protein (malate dehydrogenase)

SCOPe Domain Sequences for d1b8ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ua2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]}
lrldhnralsqiaaktgkpvssieklfvwgnhsptmyadyryaqidgasvkdminddawn
rdtflptvgkrgaaiidargvssaasaanaaidhihdwvlgtagkwttmgipsdgsygip
egvifgfpvttengeykivqglsidafsqerinvtlnelleeqngvqhllg

SCOPe Domain Coordinates for d1b8ua2:

Click to download the PDB-style file with coordinates for d1b8ua2.
(The format of our PDB-style files is described here.)

Timeline for d1b8ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b8ua1