Lineage for d1d3ab2 (1d3a B:163-330)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85227Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 85228Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 85229Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 85285Protein Malate dehydrogenase [56329] (7 species)
  7. 85303Species Haloarcula marismortui [TaxId:2238] [56335] (3 PDB entries)
  8. 85307Domain d1d3ab2: 1d3a B:163-330 [42111]
    Other proteins in same PDB: d1d3aa1, d1d3ab1

Details for d1d3ab2

PDB Entry: 1d3a (more details), 2.94 Å

PDB Description: crystal structure of the wild type halophilic malate dehydrogenase in the apo form

SCOP Domain Sequences for d1d3ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3ab2 d.162.1.1 (B:163-330) Malate dehydrogenase {Haloarcula marismortui}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg
vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

SCOP Domain Coordinates for d1d3ab2:

Click to download the PDB-style file with coordinates for d1d3ab2.
(The format of our PDB-style files is described here.)

Timeline for d1d3ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d3ab1