SCOPe 2.08: Domain d1d3ab2: 1d3a B:163-330

Lineage for d1d3ab2 (1d3a B:163-330)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Malate dehydrogenase [56329] (12 species)

7. Species Haloarcula marismortui [TaxId:2238] [56335] (6 PDB entries)

8. Domain d1d3ab2: 1d3a B:163-330 [42111]
   Other proteins in same PDB: d1d3aa1, d1d3ab1
   complexed with cl, na

Details for d1d3ab2

PDB Entry: 1d3a, 2.94 Å

PDB Description: crystal structure of the wild type halophilic malate dehydrogenase in the apo form

PDB Compounds: (B:) halophilic malate dehydrogenase

SCOPe Domain Sequences for d1d3ab2:

Sequence; same for both SEQRES and ATOM records:

>d1d3ab2 d.162.1.1 (B:163-330) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg
vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

Timeline for d1d3ab2:

• d1d3ab2 first appeared (with stable ids) in SCOP 1.55
  
• d1d3ab2 appears in SCOPe 2.07