Lineage for d1d3ab2 (1d3a B:163-330)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999154Protein Malate dehydrogenase [56329] (12 species)
  7. 2999202Species Haloarcula marismortui [TaxId:2238] [56335] (6 PDB entries)
  8. 2999212Domain d1d3ab2: 1d3a B:163-330 [42111]
    Other proteins in same PDB: d1d3aa1, d1d3ab1
    complexed with cl, na

Details for d1d3ab2

PDB Entry: 1d3a (more details), 2.94 Å

PDB Description: crystal structure of the wild type halophilic malate dehydrogenase in the apo form
PDB Compounds: (B:) halophilic malate dehydrogenase

SCOPe Domain Sequences for d1d3ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3ab2 d.162.1.1 (B:163-330) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg
vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

SCOPe Domain Coordinates for d1d3ab2:

Click to download the PDB-style file with coordinates for d1d3ab2.
(The format of our PDB-style files is described here.)

Timeline for d1d3ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d3ab1