Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Malate dehydrogenase [56329] (12 species) |
Species Haloarcula marismortui [TaxId:2238] [56335] (5 PDB entries) |
Domain d2hlpb2: 2hlp B:163-330 [42109] Other proteins in same PDB: d2hlpa1, d2hlpb1 complexed with cl, na; mutant |
PDB Entry: 2hlp (more details), 2.59 Å
SCOPe Domain Sequences for d2hlpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hlpb2 d.162.1.1 (B:163-330) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]} fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq llgdlqesamdvierkgatewgpargvahmveailhdtgrvlpasvklegefghedtafg vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis
Timeline for d2hlpb2: