Lineage for d2hlpb2 (2hlp B:163-330)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938965Protein Malate dehydrogenase [56329] (12 species)
  7. 1939013Species Haloarcula marismortui [TaxId:2238] [56335] (5 PDB entries)
  8. 1939019Domain d2hlpb2: 2hlp B:163-330 [42109]
    Other proteins in same PDB: d2hlpa1, d2hlpb1
    complexed with cl, na; mutant

Details for d2hlpb2

PDB Entry: 2hlp (more details), 2.59 Å

PDB Description: crystal structure of the e267r mutant of a halophilic malate dehydrogenase in the apo form
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d2hlpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hlpb2 d.162.1.1 (B:163-330) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgrvlpasvklegefghedtafg
vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

SCOPe Domain Coordinates for d2hlpb2:

Click to download the PDB-style file with coordinates for d2hlpb2.
(The format of our PDB-style files is described here.)

Timeline for d2hlpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hlpb1