Lineage for d1bmdb2 (1bmd B:155-332)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2605078Protein Malate dehydrogenase [56329] (12 species)
  7. 2605155Species Thermus flavus [TaxId:274] [56334] (2 PDB entries)
  8. 2605159Domain d1bmdb2: 1bmd B:155-332 [42107]
    Other proteins in same PDB: d1bmda1, d1bmdb1
    complexed with nad

Details for d1bmdb2

PDB Entry: 1bmd (more details), 1.9 Å

PDB Description: determinants of protein thermostability observed in the 1.9 angstroms crystal structure of malate dehydrogenase from the thermophilic bacterium thermus flavus
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1bmdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmdb2 d.162.1.1 (B:155-332) Malate dehydrogenase {Thermus flavus [TaxId: 274]}
trldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewye
kvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygip
egivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

SCOPe Domain Coordinates for d1bmdb2:

Click to download the PDB-style file with coordinates for d1bmdb2.
(The format of our PDB-style files is described here.)

Timeline for d1bmdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bmdb1