Lineage for d1bmda2 (1bmd A:155-332)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36979Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 36980Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 36981Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins)
  6. 37025Protein Malate dehydrogenase [56329] (7 species)
  7. 37056Species Thermus flavus [TaxId:274] [56334] (2 PDB entries)
  8. 37059Domain d1bmda2: 1bmd A:155-332 [42106]
    Other proteins in same PDB: d1bmda1, d1bmdb1

Details for d1bmda2

PDB Entry: 1bmd (more details), 1.9 Å

PDB Description: determinants of protein thermostability observed in the 1.9 angstroms crystal structure of malate dehydrogenase from the thermophilic bacterium thermus flavus

SCOP Domain Sequences for d1bmda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmda2 d.162.1.1 (A:155-332) Malate dehydrogenase {Thermus flavus}
trldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewye
kvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygip
egivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

SCOP Domain Coordinates for d1bmda2:

Click to download the PDB-style file with coordinates for d1bmda2.
(The format of our PDB-style files is described here.)

Timeline for d1bmda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bmda1