SCOPe 2.07: Domain d1bdmb2: 1bdm B:155-332

Lineage for d1bdmb2 (1bdm B:155-332)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Malate dehydrogenase [56329] (12 species)

7. Species Thermus flavus [TaxId:274] [56334] (2 PDB entries)

8. Domain d1bdmb2: 1bdm B:155-332 [42105]
   Other proteins in same PDB: d1bdma1, d1bdmb1
   complexed with nax; mutant

Details for d1bdmb2

PDB Entry: 1bdm, 1.8 Å

PDB Description: the structure at 1.8 angstroms resolution of a single site mutant (t189i) of malate dehydrogenase from thermus flavus with increased enzymatic activity

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1bdmb2:

Sequence; same for both SEQRES and ATOM records:

>d1bdmb2 d.162.1.1 (B:155-332) Malate dehydrogenase {Thermus flavus [TaxId: 274]}
trldhnrakaqlakktgtgvdrirrmtvwgnhssimfpdlfhaevdgrpalelvdmewye
kvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygip
egivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

Timeline for d1bdmb2:

• d1bdmb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bdmb2 appears in SCOPe 2.06
  
• d1bdmb2 appears in the current release, SCOPe 2.08