Lineage for d7dbke1 (7dbk E:2-161)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844354Protein Lactate dehydrogenase [51859] (19 species)
  7. 2844413Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [63939] (4 PDB entries)
  8. 3084731Domain d7dbke1: 7dbk E:2-161 [421048]
    Other proteins in same PDB: d7dbka2, d7dbkb2, d7dbkc2, d7dbkd2, d7dbke2, d7dbkf2, d7dbkg2, d7dbkh2
    automated match to d1i0za1
    complexed with gol, nai

Details for d7dbke1

PDB Entry: 7dbk (more details), 1.8 Å

PDB Description: crystal structure of human ldhb in complex with nadh
PDB Compounds: (E:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d7dbke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dbke1 c.2.1.5 (E:2-161) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]}
atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig

SCOPe Domain Coordinates for d7dbke1:

Click to download the PDB-style file with coordinates for d7dbke1.
(The format of our PDB-style files is described here.)

Timeline for d7dbke1:

  • d7dbke1 is new in SCOPe 2.08-stable