Lineage for d7cvtc2 (7cvt C:122-222)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2747968Species Mouse (Mus musculus) [TaxId:10090] [88576] (391 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 3084730Domain d7cvtc2: 7cvt C:122-222 [421047]
    Other proteins in same PDB: d7cvtc1, d7cvtd1, d7cvtd2, d7cvte1, d7cvtf1, d7cvtf2
    automated match to d1otsc2
    complexed with cl; mutant

Details for d7cvtc2

PDB Entry: 7cvt (more details), 2.9 Å

PDB Description: crystal structure of the c85a/l194a/h234c mutant clc-ec1 with fab fragment
PDB Compounds: (C:) antibody fab fragment heavy chain

SCOPe Domain Sequences for d7cvtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cvtc2 b.1.1.2 (C:122-222) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra

SCOPe Domain Coordinates for d7cvtc2:

Click to download the PDB-style file with coordinates for d7cvtc2.
(The format of our PDB-style files is described here.)

Timeline for d7cvtc2:

  • d7cvtc2 is new in SCOPe 2.08-stable