Lineage for d1bdma2 (1bdm A:155-332)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85227Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 85228Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 85229Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 85285Protein Malate dehydrogenase [56329] (7 species)
  7. 85324Species Thermus flavus [TaxId:274] [56334] (2 PDB entries)
  8. 85325Domain d1bdma2: 1bdm A:155-332 [42104]
    Other proteins in same PDB: d1bdma1, d1bdmb1

Details for d1bdma2

PDB Entry: 1bdm (more details), 1.8 Å

PDB Description: the structure at 1.8 angstroms resolution of a single site mutant (t189i) of malate dehydrogenase from thermus flavus with increased enzymatic activity

SCOP Domain Sequences for d1bdma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdma2 d.162.1.1 (A:155-332) Malate dehydrogenase {Thermus flavus}
trldhnrakaqlakktgtgvdrirrmtvwgnhssimfpdlfhaevdgrpalelvdmewye
kvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygip
egivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

SCOP Domain Coordinates for d1bdma2:

Click to download the PDB-style file with coordinates for d1bdma2.
(The format of our PDB-style files is described here.)

Timeline for d1bdma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bdma1