Lineage for d7bbta_ (7bbt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691036Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2691040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
    Uniprot P00044
  8. 3084693Domain d7bbta_: 7bbt A: [421010]
    automated match to d5t8wa_
    complexed with 15p, hec, t8w

Details for d7bbta_

PDB Entry: 7bbt (more details), 3.02 Å

PDB Description: structure of cytochrome c in complex with a p-benzyl-sulfonato- calix[8]arene-peg pseudorotaxane
PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d7bbta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bbta_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d7bbta_:

Click to download the PDB-style file with coordinates for d7bbta_.
(The format of our PDB-style files is described here.)

Timeline for d7bbta_:

  • d7bbta_ is new in SCOPe 2.08-stable