Lineage for d1civa2 (1civ A:194-385)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999154Protein Malate dehydrogenase [56329] (12 species)
  7. 2999200Species Flaveria bidentis, chloroplast [TaxId:4224] [56332] (1 PDB entry)
  8. 2999201Domain d1civa2: 1civ A:194-385 [42101]
    Other proteins in same PDB: d1civa1
    complexed with nap

Details for d1civa2

PDB Entry: 1civ (more details), 2.8 Å

PDB Description: chloroplast nadp-dependent malate dehydrogenase from flaveria bidentis
PDB Compounds: (A:) nadp-malate dehydrogenase

SCOPe Domain Sequences for d1civa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1civa2 d.162.1.1 (A:194-385) Malate dehydrogenase {Flaveria bidentis, chloroplast [TaxId: 4224]}
trldenrakcqlalkagvfydkvsnvtiwgnhsttqvpdflnakihgipvtevirdrkwl
edeftnmvqtrggvlikkwgrssaastavsivdairslvtptpegdwfstgvytngnpyg
iaedivfsmpcrskgdgdyefvkdvifddylskkikksedellaekkcvahltgegiavc
dlpedtmlpgem

SCOPe Domain Coordinates for d1civa2:

Click to download the PDB-style file with coordinates for d1civa2.
(The format of our PDB-style files is described here.)

Timeline for d1civa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1civa1