SCOPe 2.08: Domain d7colb1: 7col B:5-107

Lineage for d7colb1 (7col B:5-107)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Gluconobacter sp. [TaxId:1876758] [420965] (2 PDB entries)

8. Domain d7colb1: 7col B:5-107 [420999]
   Other proteins in same PDB: d7cola2, d7colb2
   automated match to d2hk8a1
   complexed with ndp

Details for d7colb1

PDB Entry: 7col, 1.95 Å

PDB Description: crystal structure of 5-ketofructose reductase complexed with nadph

PDB Compounds: (B:) 5-ketofructose reductase

SCOPe Domain Sequences for d7colb1:

Sequence; same for both SEQRES and ATOM records:

>d7colb1 c.58.1.0 (B:5-107) automated matches {Gluconobacter sp. [TaxId: 1876758]}
gfrsiltgsfstpcadnptvamveagyhhagldaryincdvkasgladavkgakamewvg
fncslphkvavldhlddiaesarligavncvairegklighnt

Timeline for d7colb1:

• d7colb1 is new in SCOPe 2.08-stable