Lineage for d4mdha2 (4mdh A:155-333)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680540Protein Malate dehydrogenase [56329] (12 species)
  7. 1680601Species Pig (Sus scrofa) [TaxId:9823] [56330] (3 PDB entries)
  8. 1680608Domain d4mdha2: 4mdh A:155-333 [42095]
    Other proteins in same PDB: d4mdha1, d4mdhb1
    complexed with nad, so4

Details for d4mdha2

PDB Entry: 4mdh (more details), 2.5 Å

PDB Description: refined crystal structure of cytoplasmic malate dehydrogenase at 2.5- angstroms resolution
PDB Compounds: (A:) cytoplasmic malate dehydrogenase

SCOPe Domain Sequences for d4mdha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
trldhnrakaqialklgvtsddvknviiwgnhsstqypdvnhakvklqakevgvyeavkd
dswlkgefittvqqrgaavikarklssamsaakaicdhvrdiwfgtpegefvsmgiisdg
nsygvpddllysfpvtikdktwkiveglpindfsrekmdltakelaeeketafeflssa

SCOPe Domain Coordinates for d4mdha2:

Click to download the PDB-style file with coordinates for d4mdha2.
(The format of our PDB-style files is described here.)

Timeline for d4mdha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mdha1