| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Dengue virus 4 [TaxId:11070] [195988] (5 PDB entries) |
| Domain d7a3qb2: 7a3q B:298-395 [420923] Other proteins in same PDB: d7a3qa1, d7a3qb1 automated match to d1tg8a1 complexed with 3cx, nag |
PDB Entry: 7a3q (more details), 2.7 Å
SCOPe Domain Sequences for d7a3qb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a3qb2 b.1.18.0 (B:298-395) automated matches {Dengue virus 4 [TaxId: 11070]}
sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
aentnsvtnieleppfgdsyivigvgnsaltlhwfrkg
Timeline for d7a3qb2: