Lineage for d7a3qb2 (7a3q B:298-395)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766224Species Dengue virus 4 [TaxId:11070] [195988] (5 PDB entries)
  8. 3084606Domain d7a3qb2: 7a3q B:298-395 [420923]
    Other proteins in same PDB: d7a3qa1, d7a3qb1
    automated match to d1tg8a1
    complexed with 3cx, nag

Details for d7a3qb2

PDB Entry: 7a3q (more details), 2.7 Å

PDB Description: crystal structure of dengue 4 virus envelope glycoprotein in complex with the scfv fragment of the broadly neutralizing human antibody ede1 c10
PDB Compounds: (B:) Envelope protein E

SCOPe Domain Sequences for d7a3qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a3qb2 b.1.18.0 (B:298-395) automated matches {Dengue virus 4 [TaxId: 11070]}
sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
aentnsvtnieleppfgdsyivigvgnsaltlhwfrkg

SCOPe Domain Coordinates for d7a3qb2:

Click to download the PDB-style file with coordinates for d7a3qb2.
(The format of our PDB-style files is described here.)

Timeline for d7a3qb2:

  • d7a3qb2 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7a3qb1