Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) |
Protein automated matches [226969] (5 species) not a true protein |
Species Dengue virus 4 [TaxId:11070] [420818] (1 PDB entry) |
Domain d7a3qb1: 7a3q B:1-297 [420922] Other proteins in same PDB: d7a3qa2, d7a3qb2 automated match to d1tg8a2 complexed with 3cx, nag |
PDB Entry: 7a3q (more details), 2.7 Å
SCOPe Domain Sequences for d7a3qb1:
Sequence, based on SEQRES records: (download)
>d7a3qb1 f.10.1.1 (B:1-297) automated matches {Dengue virus 4 [TaxId: 11070]} mrcvgvgnrdfvegvsggawvdlvlehggcvttmaqgkptldfeltkttakevallrtyc ieasisnittatrcptqgepylkeeqdqqyicrrdvvdrgwgngcglfgkggvvtcakfs csgkitgnlvqienleytvvvtvhngdthavgndtsnhgvtamitprspsvevklpdyge ltldceprsgidfnemilmkmkkktwlvhkqwfldlplpwtagadtsevhwnykermvtf kvphakrqdvtvlgsqegamhsalagatevdsgdgnhmfaghlkckvrmeklrikgm
>d7a3qb1 f.10.1.1 (B:1-297) automated matches {Dengue virus 4 [TaxId: 11070]} mrcvgvgnrdfvegvsvdlvlehggcvttmaqgkptldfeltkttakevallrtycieas isnittatrcptqgepylkeeqdqqyicrrdvvdrgwgngcglfgkggvvtcakfscsgk itgnlvqienleytvvvtvhnhgvtamitprspsvevklpdygeltldceprsgidfnem ilmkmkkktwlvhkqwfldlplpwtagevhwnykermvtfkvpqdvtvlgsqegamhsal agatevdhmfaghlkckvrmeklrikgm
Timeline for d7a3qb1: