Lineage for d7cwga_ (7cwg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737203Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)
  8. 3084575Domain d7cwga_: 7cwg A: [420892]
    automated match to d3ecma_
    complexed with gju, mg, zn

Details for d7cwga_

PDB Entry: 7cwg (more details), 2.8 Å

PDB Description: crystal structure of pde8a catalytic domain in complex with 3a
PDB Compounds: (A:) High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

SCOPe Domain Sequences for d7cwga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cwga_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddvppriarameneeywdfdifeleaathnrpliylglkmfarfgiceflhcsestlrsw
lqiieanyhssnpyhnsthsadvlhatayflskeriketldpidevaaliaatihdvdhp
grtnsflcnagselailyndtavleshhaalafqlttgddkcnifknmerndyrtlrqgi
idmvlatemtkhfehvnkfvnsinkplatleengetdknqevintmlrtpenrtlikrml
ikcadvsnpcrplqyciewaariseeyfsqtdeekqqglpvvmpvfdrntcsipksqisf
idyfitdmfdawdafvdlpdlmqhldnnfkywkgldem

SCOPe Domain Coordinates for d7cwga_:

Click to download the PDB-style file with coordinates for d7cwga_.
(The format of our PDB-style files is described here.)

Timeline for d7cwga_:

  • d7cwga_ is new in SCOPe 2.08-stable