Lineage for d1emsb2 (1ems B:10-280)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36966Fold d.160: Nitrilase/N-carbamyl-D-aminoacid amidohydrolase [56316] (1 superfamily)
  4. 36967Superfamily d.160.1: Nitrilase/N-carbamyl-D-aminoacid amidohydrolase [56317] (1 family) (S)
  5. 36968Family d.160.1.1: Nitrilase [56318] (1 protein)
  6. 36969Protein NIT-FHIT fusion protein, N-terminal domain [56319] (1 species)
  7. 36970Species Worm (Caenorhabditis elegans) [56320] (1 PDB entry)
  8. 36972Domain d1emsb2: 1ems B:10-280 [42087]
    Other proteins in same PDB: d1emsa1, d1emsb1

Details for d1emsb2

PDB Entry: 1ems (more details), 2.8 Å

PDB Description: crystal structure of the c. elegans nitfhit protein

SCOP Domain Sequences for d1emsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emsb2 d.160.1.1 (B:10-280) NIT-FHIT fusion protein, N-terminal domain {Worm (Caenorhabditis elegans)}
matgrhfiavcqmtsdndleknfqaaknmieragekkcemvflpecfdfiglnkneqidl
amatdceymekyrelarkhniwlslgglhhkdpsdaahpwnthliidsdgvtraeynklh
lfdleipgkvrlmesefskagtemippvdtpigrlglsicydvrfpelslwnrkrgaqll
sfpsaftlntglahwetllraraienqcyvvaaaqtgahnpkrqsyghsmvvdpwgavva
qcservdmcfaeidlsyvdtlremqpvfshr

SCOP Domain Coordinates for d1emsb2:

Click to download the PDB-style file with coordinates for d1emsb2.
(The format of our PDB-style files is described here.)

Timeline for d1emsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emsb1