Lineage for d1emsa2 (1ems A:10-280)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families) (S)
    Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases
  5. Family d.160.1.1: Nitrilase [56318] (2 proteins)
  6. Protein NIT-FHIT fusion protein, N-terminal domain [56319] (1 species)
  7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [56320] (1 PDB entry)
  8. Domain d1emsa2: 1ems A:10-280 [42086]
    Other proteins in same PDB: d1emsa1, d1emsb1
    complexed with emc, mpd, na

Details for d1emsa2

PDB Entry: 1ems (more details), 2.8 Å

PDB Description: crystal structure of the c. elegans nitfhit protein
PDB Compounds: (A:) nit-fragile histidine triad fusion protein

SCOPe Domain Sequences for d1emsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emsa2 d.160.1.1 (A:10-280) NIT-FHIT fusion protein, N-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
matgrhfiavcqmtsdndleknfqaaknmieragekkcemvflpecfdfiglnkneqidl
amatdceymekyrelarkhniwlslgglhhkdpsdaahpwnthliidsdgvtraeynklh
lfdleipgkvrlmesefskagtemippvdtpigrlglsicydvrfpelslwnrkrgaqll
sfpsaftlntglahwetllraraienqcyvvaaaqtgahnpkrqsyghsmvvdpwgavva
qcservdmcfaeidlsyvdtlremqpvfshr

SCOPe Domain Coordinates for d1emsa2 are not available.

Timeline for d1emsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emsa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1emsb1, d1emsb2