Lineage for d1auia_ (1aui A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876798Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 876799Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 876853Family d.159.1.3: Protein serine/threonine phosphatase [56310] (5 proteins)
  6. 876890Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species)
  7. 876893Species Human (Homo sapiens) [TaxId:9606] [56315] (4 PDB entries)
  8. 876894Domain d1auia_: 1aui A: [42085]
    Other proteins in same PDB: d1auib_
    complexed with ca, fe, zn

Details for d1auia_

PDB Entry: 1aui (more details), 2.1 Å

PDB Description: human calcineurin heterodimer
PDB Compounds: (A:) serine/threonine phosphatase 2b

SCOP Domain Sequences for d1auia_:

Sequence, based on SEQRES records: (download)

>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]}
tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlnics
ddelgseedgfdgataaarkevirnkiraigkmarvfsvlreesesvltlkgltptgmlp
sgvlsggkqtlqsatveaieadeaikgfspqhkitsfeeakgldrinermppr

Sequence, based on observed residues (ATOM records): (download)

>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]}
tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlnics
sfeeakgldrinermppr

SCOP Domain Coordinates for d1auia_:

Click to download the PDB-style file with coordinates for d1auia_.
(The format of our PDB-style files is described here.)

Timeline for d1auia_: