Lineage for d1tcoa_ (1tco A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513455Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 513456Superfamily d.159.1: Metallo-dependent phosphatases [56300] (7 families) (S)
  5. 513496Family d.159.1.3: Protein serine/threonine phosphatase [56310] (4 proteins)
  6. 513513Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species)
  7. 513514Species Cow (Bos taurus) [TaxId:9913] [56314] (1 PDB entry)
  8. 513515Domain d1tcoa_: 1tco A: [42084]
    Other proteins in same PDB: d1tcob_, d1tcoc_

Details for d1tcoa_

PDB Entry: 1tco (more details), 2.5 Å

PDB Description: ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)

SCOP Domain Sequences for d1tcoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcoa_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Cow (Bos taurus)}
vpfppshrltakevfdndgkprvdilkahlmkegrleetvalriitegasilrqeknlld
idapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlylwalkily
pktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnqqflcvhg
glspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntvrgcsyfy
sypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyldvynnkaa
vlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlnic

SCOP Domain Coordinates for d1tcoa_:

Click to download the PDB-style file with coordinates for d1tcoa_.
(The format of our PDB-style files is described here.)

Timeline for d1tcoa_: