SCOPe 2.08: Domain d7a3qa2: 7a3q A:298-394

Lineage for d7a3qa2 (7a3q A:298-394)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Dengue virus 4 [TaxId:11070] [195988] (5 PDB entries)

8. Domain d7a3qa2: 7a3q A:298-394 [420820]
   Other proteins in same PDB: d7a3qa1, d7a3qb1
   automated match to d1tg8a1
   complexed with 3cx, nag

Details for d7a3qa2

PDB Entry: 7a3q, 2.7 Å

PDB Description: crystal structure of dengue 4 virus envelope glycoprotein in complex with the scfv fragment of the broadly neutralizing human antibody ede1 c10

PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d7a3qa2:

Sequence; same for both SEQRES and ATOM records:

>d7a3qa2 b.1.18.0 (A:298-394) automated matches {Dengue virus 4 [TaxId: 11070]}
sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
aentnsvtnieleppfgdsyivigvgnsaltlhwfrk

Timeline for d7a3qa2:

• d7a3qa2 is new in SCOPe 2.08-stable